Pay in 4 interest-free payments of $144.50 Learn more
Ships within 48 hours · Estimated delivery Aug 8 - Aug 13
Gene Names:Name:tmem208 ORF Names:DDB_G0281177
Uniprot ID: P78025
Gene Names: DEFB4A
Abbreviation:IL-22
AA Sequence:KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDAS ESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVL LGFLYRYYTSESKSS
Monkey Taste receptor type 1 member 2 (TAS1R2) ELISA Kit Next Gen Seq Gene Names:Name:tmem208 ORF Names:DDB_G0281177Size: 96T. Other sizes are also available. Species Reactivity: Monkey (Simian) UniProt: A3QP01 Abbreviation: TAS1R2 Alternative Names: GPR71; T1R2; TR2; G protein coupled receptor 71 Application: ELISA Range: Request Information Sensitivity: Request Information Test principle: This assay employs a two site sandwich ELISA to quantitate TAS1R2 in samples. An antibody specific for TAS1R2 has been pre coated onto a microplate. Standards and samples are
US$ 1000.00
US$ 3000.00
US$ 10000.00
US$ 1250.00
US$ 1100.00
